Wednesday, August 6, 2025
No Result
View All Result
Monde Ball
  • Home
  • Latest News
    Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

    Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

    “I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

    “I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

    Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price

    Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price

    Tottenham are keeping a close eye on Barcelona star Marc Casado

    Tottenham are keeping a close eye on Barcelona star Marc Casado

    Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025

    Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025

    West Ham reach verbal agreement for £9m “warrior”

    West Ham reach verbal agreement for £9m “warrior”

    Fabio Vieira set for Stuttgart? Young French defender linked

    Fabio Vieira set for Stuttgart? Young French defender linked

    Arsenal’s classy 2025/26 third kit hits shelves

    Arsenal’s classy 2025/26 third kit hits shelves

    Slot impressed by Ekitike and Ngumoha in Bilbao wins

    Slot impressed by Ekitike and Ngumoha in Bilbao wins

  • Transfers & Deals
    Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

    Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

    FC Barcelona transfers and new player signings 2025/26

    FC Barcelona transfers and new player signings 2025/26

    Rodrygo makes a final decision on his future amidst Arsenal’s interest

    Rodrygo makes a final decision on his future amidst Arsenal’s interest

    Leipzig Ask About George In Simons Talks

    Leipzig Ask About George In Simons Talks

    I broke Wayne Rooney’s club record but was driving a taxi three years later

    I broke Wayne Rooney’s club record but was driving a taxi three years later

    Liverpool scouting 3 young centre-backs with transfer plans explained – Liverpool FC

    Liverpool scouting 3 young centre-backs with transfer plans explained – Liverpool FC

    Arsenal monitoring situation of Real Madrid star who has not signed a new deal

    Arsenal monitoring situation of Real Madrid star who has not signed a new deal

    Blues to Bid for Switzerland’s “Greatest Talent”

    Blues to Bid for Switzerland’s “Greatest Talent”

    Liverpool’s ‘take it or leave it’ £110m bid for Alexander Isak rejected by Newcastle | Liverpool

    Liverpool’s ‘take it or leave it’ £110m bid for Alexander Isak rejected by Newcastle | Liverpool

  • England
    • All
    • Arsenal
    • Chelsea
    • Liverpool
    • Manchester City
    • Manchester United
    • Tottenham Hotspur
    Welcome to the new Cartilage Free Captain: A fresh look, fewer ads and a new feature

    Welcome to the new Cartilage Free Captain: A fresh look, fewer ads and a new feature

    Liverpool set £50M asking price amid summer transfer talks

    Liverpool set £50M asking price amid summer transfer talks

    Arsenal is now set to move for Eberechi Eze alternatives

    Arsenal is now set to move for Eberechi Eze alternatives

    Manchester City target new deals for Rodri and Phil Foden

    Manchester City target new deals for Rodri and Phil Foden

    Tyrique George is promising but it’s best for all if he departs Chelsea

    Tyrique George is promising but it’s best for all if he departs Chelsea

    Maguire: I’ll give everything to this club

    Maguire: I’ll give everything to this club

    Five more things learnt from Liverpool vs Athletic Club pre-season friendly

    Five more things learnt from Liverpool vs Athletic Club pre-season friendly

    Bernardo Silva: We are really focused on improving and challenging for silverware again,”

    Bernardo Silva: We are really focused on improving and challenging for silverware again,”

    Chelsea green light sign Ademola Lookman

    Chelsea green light sign Ademola Lookman

    • Arsenal
    • Chelsea
    • Liverpool
    • Manchester United
    • Manchester City
    • Tottenham Hotspur
  • Spain
    • All
    • Atlético Madrid
    • FC Barcelona
    • Real Madrid
    La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

    La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

    you have to do it today

    you have to do it today

    “The train does not pass once, many never happens to them”

    “The train does not pass once, many never happens to them”

    Napoli considering €70m swoop for 21-year-old Barcelona midfielder to pair with De Bruyne – report

    Napoli considering €70m swoop for 21-year-old Barcelona midfielder to pair with De Bruyne – report

    Atletico Madrid captain responds to Saul Niguez ‘excuse’ remarks

    Atletico Madrid captain responds to Saul Niguez ‘excuse’ remarks

    Problem rodrygo

    Problem rodrygo

    How Barcelona intend to bypass Ter Stegen’s reluctance using his own public comments

    How Barcelona intend to bypass Ter Stegen’s reluctance using his own public comments

    Nor girl-of-image idea-the gallerna

    Nor girl-of-image idea-the gallerna

    the rule you must follow

    the rule you must follow

    • Real Madrid
    • FC Barcelona
    • Atlético Madrid
  • Germany
    • All
    • Bayern Munich
    • Borussia Dortmund
    Franck Ribéry speaks on his son Seïf Ribéry from Bayern Munich U-14s

    Franck Ribéry speaks on his son Seïf Ribéry from Bayern Munich U-14s

    Former German World Cup winner Frank Mill dies at age 67

    Former German World Cup winner Frank Mill dies at age 67

    Borussia Dortmund & Germany Star Joins Chelsea & RB Leipzig Forwards On Inter Milan List Of Backup Targets For Ademola Lookman

    Borussia Dortmund & Germany Star Joins Chelsea & RB Leipzig Forwards On Inter Milan List Of Backup Targets For Ademola Lookman

    Daily Schmankerl: Lothar Matthew Unsure about Bavaria Munich’s Transfer Strategy; Bavaria Eying Atlético Madrid Youngster?; Manchester United Wants FC Barcelona’s Fermín López; Tottenham Hotspur Could Make Move for Randal Kolo Muani; and more!

    Daily Schmankerl: Lothar Matthew Unsure about Bavaria Munich’s Transfer Strategy; Bavaria Eying Atlético Madrid Youngster?; Manchester United Wants FC Barcelona’s Fermín López; Tottenham Hotspur Could Make Move for Randal Kolo Muani; and more!

    Tottenham Fans All Say the Same About Joao Palhinha After Summer Arrival

    Tottenham Fans All Say the Same About Joao Palhinha After Summer Arrival

    Joao Palhinha: Tottenham Sign Bayern Munich Midfielder on Loan

    Joao Palhinha: Tottenham Sign Bayern Munich Midfielder on Loan

    Health update given on Bayern Munich president Uli Hoeness after 73-year-old was rushed to hospital after suffering ‘burst vein’ at charity golf event

    Health update given on Bayern Munich president Uli Hoeness after 73-year-old was rushed to hospital after suffering ‘burst vein’ at charity golf event

    Borussia Dortmund take legal action against AfD election sticker

    Borussia Dortmund take legal action against AfD election sticker

    Confirmed Lineups: Borussia Dortmund vs. LOSC Lille

    Confirmed Lineups: Borussia Dortmund vs. LOSC Lille

    • Bayern Munich
    • Borussia Dortmund
  • France
    • All
    • Paris Saint-Germain (PSG)
    Fabrizio Romano Gives Chelsea Transfer Update on Arsenal Target With PSG Clause

    Fabrizio Romano Gives Chelsea Transfer Update on Arsenal Target With PSG Clause

    Res. Social: Nuno Mendes was tattooed the historic season of PSG

    Res. Social: Nuno Mendes was tattooed the historic season of PSG

    10 days from PSG, Tottenham is worried about James Maddison

    10 days from PSG, Tottenham is worried about James Maddison

    His said goodbye, injured Maddison: Tottenham shaken – News

    His said goodbye, injured Maddison: Tottenham shaken – News

    Unai Emery Wants PSG Outcast Who Won’t Take Paycut at Aston Villa

    Unai Emery Wants PSG Outcast Who Won’t Take Paycut at Aston Villa

    Terrible blow for Saint-Etienne before Laval!

    Terrible blow for Saint-Etienne before Laval!

    PSG will hit five times in the transfer window

    PSG will hit five times in the transfer window

    “He would face 15 years in prison”

    “He would face 15 years in prison”

    This is the UEFA sanction to the PSG for the violent acts of their ultras in the celebrations for victory in the Champions

    This is the UEFA sanction to the PSG for the violent acts of their ultras in the celebrations for victory in the Champions

    • Paris Saint-Germain (PSG)
  • Italy
    • All
    • AC Milan
    • AS Roma
    • Inter Milan
    • Juventus
    “I would stay at Roma for life.”

    “I would stay at Roma for life.”

    Welcome to the new The AC Milan Offside: A fresh look, fewer ads and a new feature

    Welcome to the new The AC Milan Offside: A fresh look, fewer ads and a new feature

    ‘Maestro meets Mister’ – Allegri and Modric embrace at Milanello on first day: photo

    ‘Maestro meets Mister’ – Allegri and Modric embrace at Milanello on first day: photo

    Stats show Modric remains elite

    Stats show Modric remains elite

    Juventus Compile a Long List of Players to Offload

    Juventus Compile a Long List of Players to Offload

    Inter Milan adds Juventus midfielder to their shopping list

    Inter Milan adds Juventus midfielder to their shopping list

    Neymar back in the Champions League: Brazil star makes transfer demand

    Neymar back in the Champions League: Brazil star makes transfer demand

    Gasperini warning Roma captaincy will rotate in 2025-26 between players with most games

    Gasperini warning Roma captaincy will rotate in 2025-26 between players with most games

    Milan working to finalize the Jashari agreement with Club Brugge in a deal worth nearly €40m | Rossoneri Blog

    Milan working to finalize the Jashari agreement with Club Brugge in a deal worth nearly €40m | Rossoneri Blog

    • Juventus
    • AC Milan
    • Inter Milan
    • AS Roma
  • Stats
  • Home
  • Latest News
    Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

    Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

    “I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

    “I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

    Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price

    Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price

    Tottenham are keeping a close eye on Barcelona star Marc Casado

    Tottenham are keeping a close eye on Barcelona star Marc Casado

    Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025

    Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025

    West Ham reach verbal agreement for £9m “warrior”

    West Ham reach verbal agreement for £9m “warrior”

    Fabio Vieira set for Stuttgart? Young French defender linked

    Fabio Vieira set for Stuttgart? Young French defender linked

    Arsenal’s classy 2025/26 third kit hits shelves

    Arsenal’s classy 2025/26 third kit hits shelves

    Slot impressed by Ekitike and Ngumoha in Bilbao wins

    Slot impressed by Ekitike and Ngumoha in Bilbao wins

  • Transfers & Deals
    Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

    Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

    FC Barcelona transfers and new player signings 2025/26

    FC Barcelona transfers and new player signings 2025/26

    Rodrygo makes a final decision on his future amidst Arsenal’s interest

    Rodrygo makes a final decision on his future amidst Arsenal’s interest

    Leipzig Ask About George In Simons Talks

    Leipzig Ask About George In Simons Talks

    I broke Wayne Rooney’s club record but was driving a taxi three years later

    I broke Wayne Rooney’s club record but was driving a taxi three years later

    Liverpool scouting 3 young centre-backs with transfer plans explained – Liverpool FC

    Liverpool scouting 3 young centre-backs with transfer plans explained – Liverpool FC

    Arsenal monitoring situation of Real Madrid star who has not signed a new deal

    Arsenal monitoring situation of Real Madrid star who has not signed a new deal

    Blues to Bid for Switzerland’s “Greatest Talent”

    Blues to Bid for Switzerland’s “Greatest Talent”

    Liverpool’s ‘take it or leave it’ £110m bid for Alexander Isak rejected by Newcastle | Liverpool

    Liverpool’s ‘take it or leave it’ £110m bid for Alexander Isak rejected by Newcastle | Liverpool

  • England
    • All
    • Arsenal
    • Chelsea
    • Liverpool
    • Manchester City
    • Manchester United
    • Tottenham Hotspur
    Welcome to the new Cartilage Free Captain: A fresh look, fewer ads and a new feature

    Welcome to the new Cartilage Free Captain: A fresh look, fewer ads and a new feature

    Liverpool set £50M asking price amid summer transfer talks

    Liverpool set £50M asking price amid summer transfer talks

    Arsenal is now set to move for Eberechi Eze alternatives

    Arsenal is now set to move for Eberechi Eze alternatives

    Manchester City target new deals for Rodri and Phil Foden

    Manchester City target new deals for Rodri and Phil Foden

    Tyrique George is promising but it’s best for all if he departs Chelsea

    Tyrique George is promising but it’s best for all if he departs Chelsea

    Maguire: I’ll give everything to this club

    Maguire: I’ll give everything to this club

    Five more things learnt from Liverpool vs Athletic Club pre-season friendly

    Five more things learnt from Liverpool vs Athletic Club pre-season friendly

    Bernardo Silva: We are really focused on improving and challenging for silverware again,”

    Bernardo Silva: We are really focused on improving and challenging for silverware again,”

    Chelsea green light sign Ademola Lookman

    Chelsea green light sign Ademola Lookman

    • Arsenal
    • Chelsea
    • Liverpool
    • Manchester United
    • Manchester City
    • Tottenham Hotspur
  • Spain
    • All
    • Atlético Madrid
    • FC Barcelona
    • Real Madrid
    La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

    La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

    you have to do it today

    you have to do it today

    “The train does not pass once, many never happens to them”

    “The train does not pass once, many never happens to them”

    Napoli considering €70m swoop for 21-year-old Barcelona midfielder to pair with De Bruyne – report

    Napoli considering €70m swoop for 21-year-old Barcelona midfielder to pair with De Bruyne – report

    Atletico Madrid captain responds to Saul Niguez ‘excuse’ remarks

    Atletico Madrid captain responds to Saul Niguez ‘excuse’ remarks

    Problem rodrygo

    Problem rodrygo

    How Barcelona intend to bypass Ter Stegen’s reluctance using his own public comments

    How Barcelona intend to bypass Ter Stegen’s reluctance using his own public comments

    Nor girl-of-image idea-the gallerna

    Nor girl-of-image idea-the gallerna

    the rule you must follow

    the rule you must follow

    • Real Madrid
    • FC Barcelona
    • Atlético Madrid
  • Germany
    • All
    • Bayern Munich
    • Borussia Dortmund
    Franck Ribéry speaks on his son Seïf Ribéry from Bayern Munich U-14s

    Franck Ribéry speaks on his son Seïf Ribéry from Bayern Munich U-14s

    Former German World Cup winner Frank Mill dies at age 67

    Former German World Cup winner Frank Mill dies at age 67

    Borussia Dortmund & Germany Star Joins Chelsea & RB Leipzig Forwards On Inter Milan List Of Backup Targets For Ademola Lookman

    Borussia Dortmund & Germany Star Joins Chelsea & RB Leipzig Forwards On Inter Milan List Of Backup Targets For Ademola Lookman

    Daily Schmankerl: Lothar Matthew Unsure about Bavaria Munich’s Transfer Strategy; Bavaria Eying Atlético Madrid Youngster?; Manchester United Wants FC Barcelona’s Fermín López; Tottenham Hotspur Could Make Move for Randal Kolo Muani; and more!

    Daily Schmankerl: Lothar Matthew Unsure about Bavaria Munich’s Transfer Strategy; Bavaria Eying Atlético Madrid Youngster?; Manchester United Wants FC Barcelona’s Fermín López; Tottenham Hotspur Could Make Move for Randal Kolo Muani; and more!

    Tottenham Fans All Say the Same About Joao Palhinha After Summer Arrival

    Tottenham Fans All Say the Same About Joao Palhinha After Summer Arrival

    Joao Palhinha: Tottenham Sign Bayern Munich Midfielder on Loan

    Joao Palhinha: Tottenham Sign Bayern Munich Midfielder on Loan

    Health update given on Bayern Munich president Uli Hoeness after 73-year-old was rushed to hospital after suffering ‘burst vein’ at charity golf event

    Health update given on Bayern Munich president Uli Hoeness after 73-year-old was rushed to hospital after suffering ‘burst vein’ at charity golf event

    Borussia Dortmund take legal action against AfD election sticker

    Borussia Dortmund take legal action against AfD election sticker

    Confirmed Lineups: Borussia Dortmund vs. LOSC Lille

    Confirmed Lineups: Borussia Dortmund vs. LOSC Lille

    • Bayern Munich
    • Borussia Dortmund
  • France
    • All
    • Paris Saint-Germain (PSG)
    Fabrizio Romano Gives Chelsea Transfer Update on Arsenal Target With PSG Clause

    Fabrizio Romano Gives Chelsea Transfer Update on Arsenal Target With PSG Clause

    Res. Social: Nuno Mendes was tattooed the historic season of PSG

    Res. Social: Nuno Mendes was tattooed the historic season of PSG

    10 days from PSG, Tottenham is worried about James Maddison

    10 days from PSG, Tottenham is worried about James Maddison

    His said goodbye, injured Maddison: Tottenham shaken – News

    His said goodbye, injured Maddison: Tottenham shaken – News

    Unai Emery Wants PSG Outcast Who Won’t Take Paycut at Aston Villa

    Unai Emery Wants PSG Outcast Who Won’t Take Paycut at Aston Villa

    Terrible blow for Saint-Etienne before Laval!

    Terrible blow for Saint-Etienne before Laval!

    PSG will hit five times in the transfer window

    PSG will hit five times in the transfer window

    “He would face 15 years in prison”

    “He would face 15 years in prison”

    This is the UEFA sanction to the PSG for the violent acts of their ultras in the celebrations for victory in the Champions

    This is the UEFA sanction to the PSG for the violent acts of their ultras in the celebrations for victory in the Champions

    • Paris Saint-Germain (PSG)
  • Italy
    • All
    • AC Milan
    • AS Roma
    • Inter Milan
    • Juventus
    “I would stay at Roma for life.”

    “I would stay at Roma for life.”

    Welcome to the new The AC Milan Offside: A fresh look, fewer ads and a new feature

    Welcome to the new The AC Milan Offside: A fresh look, fewer ads and a new feature

    ‘Maestro meets Mister’ – Allegri and Modric embrace at Milanello on first day: photo

    ‘Maestro meets Mister’ – Allegri and Modric embrace at Milanello on first day: photo

    Stats show Modric remains elite

    Stats show Modric remains elite

    Juventus Compile a Long List of Players to Offload

    Juventus Compile a Long List of Players to Offload

    Inter Milan adds Juventus midfielder to their shopping list

    Inter Milan adds Juventus midfielder to their shopping list

    Neymar back in the Champions League: Brazil star makes transfer demand

    Neymar back in the Champions League: Brazil star makes transfer demand

    Gasperini warning Roma captaincy will rotate in 2025-26 between players with most games

    Gasperini warning Roma captaincy will rotate in 2025-26 between players with most games

    Milan working to finalize the Jashari agreement with Club Brugge in a deal worth nearly €40m | Rossoneri Blog

    Milan working to finalize the Jashari agreement with Club Brugge in a deal worth nearly €40m | Rossoneri Blog

    • Juventus
    • AC Milan
    • Inter Milan
    • AS Roma
  • Stats
No Result
View All Result
Monde Ball
No Result
View All Result

21-year-old playmaker emerges as transfer target

July 15, 2025
in Latest News
Reading Time: 3 mins read
0 0
A A
0
Home Latest News
Share on FacebookShare on Twitter


Bilal El Khannouss may be a part of Sunderland this summer season (Photograph by Michael Regan/Getty Pictures)

Sunderland have had an excellent summer season switch window up till now, and issues may quickly get even higher for the newly-promoted aspect.

Enzo Le Charge, Habib Diarra, Noah Sadiki, Reinildo Mandava, Chemsdine Talbi and Simon Adringa have already jetted in to the Stadium of Gentle, and there shall be extra to return. It’s been famous that the overwhelming majority of those gamers are from Africa, and whereas this might trigger issues when the Africa Cup of Nations takes place within the winter, the membership shouldn’t be deterred.

And that has been proven within the newest participant they’ve taken an curiosity in.

Sunderland register curiosity in Bilal El Khannouss

Bilal El Khannouss in motion for Leicester Metropolis (Photograph by Carl Recine/Getty Pictures)

In keeping with L’Equipe (by way of Sunderland Echo), Sunderland are enthusiastic about signing Bilal El Khannouss. The Moroccan playmaker impressed for relegated Leicester final season, and his reward may very well be to remain within the Premier League.

El Khannouss, who registered three targets and 5 assists through the 2024-25 marketing campaign, had earlier attracted curiosity from Arsenal, however he may now be set for a transfer to Sunderland. Nevertheless, there may be competitors from Ligue 1 aspect AS Monaco, who may make it tough for the north East membership to get their man.

Extra Tales / Newest Information

El Khannouss can be a wonderful signing for Sunderland, and though it has solely been one season, his Premier League expertise shall be worthwhile – particularly provided that they’re anticipated to be in a relegation battle, like Leicester had been final season.

It stays to be seen whether or not Sunderland’s curiosity in El Khannouss leads to a concrete try and signal him. It might be a shock if he stayed at Leicester for the 2025-26 season, so there are possibilities for a deal to be finished earlier than the summer season switch window closes at the beginning of September.



Source link

Tags: 21yearoldemergesplaymakertargettransfer
Previous Post

Unusual: Trump ignored Infantino and stayed on the podium with Chelsea

Next Post

Inter Eager to Offload Veteran, Identify New Priority

Related Posts

Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call
Latest News

Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

August 6, 2025

Micky Mellon was crucial of Oldham gamers with a Carabao Cup Preliminary Spherical defeat to Accrington a get up name....

“I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results
Latest News

“I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

August 6, 2025

Hamburger SV supervisor, Merlin Polzin is delighted to have Ghanaian striker Ransford-Yeboah Konigsdorffer again in his crew following his botched...

Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price
Latest News

Napoli resume Musah talks with AC Milan, awaiting Nottingham Forest at 30m price

August 5, 2025

SINGAPORE, SINGAPORE - JULY 23: Yunus Musah of AC Milan runs with the ball throughout the Pre-Season Pleasant match between...

Tottenham are keeping a close eye on Barcelona star Marc Casado
Latest News

Tottenham are keeping a close eye on Barcelona star Marc Casado

August 5, 2025

Tottenham Hotspur are conserving a detailed watch on the scenario of Barcelona’s rising star Marc Casado, as they contemplate a...

Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025
Latest News

Why David De Gea will receive a good Old Trafford reception for Man Utd v Fiorentina | 4 August 2025

August 5, 2025

De Gea made an unimaginable 415 Premier League begins for the Reds, together with all through the 2012/13 marketing campaign,...

West Ham reach verbal agreement for £9m “warrior”
Latest News

West Ham reach verbal agreement for £9m “warrior”

August 5, 2025

After a usually constructive Premier League Summer season Sequence marketing campaign, can West Ham United begin to construct some positivity...

Next Post
Inter Eager to Offload Veteran, Identify New Priority

Inter Eager to Offload Veteran, Identify New Priority

Newcastle exploring a move for “unbelievable” £50m star

Newcastle exploring a move for “unbelievable” £50m star

Leave a Reply Cancel reply

Your email address will not be published. Required fields are marked *

  • Trending
  • Comments
  • Latest
La Liga Prize Money for Winners 2024-25: Distribution & Breakdown

La Liga Prize Money for Winners 2024-25: Distribution & Breakdown

July 2, 2025
Kevin De Bruyne arrives for Napoli transfer

Kevin De Bruyne arrives for Napoli transfer

June 15, 2025
Xabi Alonso, ‘one of the greatest legends of Real Madrid’, appointed as head coach | Real Madrid

Xabi Alonso, ‘one of the greatest legends of Real Madrid’, appointed as head coach | Real Madrid

June 15, 2025
Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call

August 6, 2025
Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window

August 6, 2025
“I would stay at Roma for life.”

“I would stay at Roma for life.”

August 6, 2025
La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

La Liga President goes off at Real Madrid’s Florentino Perez with 5am rant

August 6, 2025
you have to do it today

you have to do it today

August 6, 2025
“I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

“I am happy to have him back”- Hamburger manager opens up on Ransford Konigsdorffer’s failed OGC Nice move – Ghana Latest Football News, Live Scores, Results

August 6, 2025
Monde Ball

Stay ahead with Monde Ball: real-time football news, live scores, transfer updates, tactical analysis, and exclusive interviews from leagues around the world—all in one place.

Navigation

  • Latest News
  • Transfers & Deals
  • England
  • Spain
  • Germany
  • France
  • Italy

Quick Links

  • About Us
  • Advertise With Us
  • Disclaimer
  • Privacy Policy
  • DMCA
  • Cookie Privacy Policy
  • Terms and Conditions
  • Contact

Latest Updates

  • Micky Mellon critical of Oldham players with Carabao Cup defeat to Accrington a wake up call
  • Football transfer rumours: Liverpool’s Harvey Elliott on his way to Leipzig? | Transfer window
  • “I would stay at Roma for life.”
  • About Us
  • Advertise With Us
  • Disclaimer
  • Privacy Policy
  • DMCA
  • Cookie Privacy Policy
  • Terms and Conditions
  • Contact

Copyright © 2025 Monde Ball.
Monde Ball is not responsible for the content of external sites.

No Result
View All Result
  • Home
  • Latest News
  • Transfers & Deals
  • England
    • Arsenal
    • Chelsea
    • Liverpool
    • Manchester United
    • Manchester City
    • Tottenham Hotspur
  • Spain
    • Real Madrid
    • FC Barcelona
    • Atlético Madrid
  • Germany
    • Bayern Munich
    • Borussia Dortmund
  • France
    • Paris Saint-Germain (PSG)
  • Italy
    • Juventus
    • AC Milan
    • Inter Milan
    • AS Roma
  • Stats

Copyright © 2025 Monde Ball.
Monde Ball is not responsible for the content of external sites.

Welcome Back!

Login to your account below

Forgotten Password?

Retrieve your password

Please enter your username or email address to reset your password.

Log In